Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5) anticorps

Antigène

Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5)

Synonymes ACS2, ACS5, FACL5, Acs5, Facl5, ACSL5, 1700030F05Rik, zgc:92083, MGC138948
Clonalité Monoclonal (5H8)
Hôte
Alternatives

Souris

Reactivité
Alternatives

Humain

Application
Alternatives Transfer Western (WB), Immunohistochimie (IHC), ELISA
Certificats ISO 9001:2008
N° du produit ABIN168958
Quantité 100 µg
Prix 320,00 €   Frais d\'envoi €40,00, €20,00 glace carbonique et TVA exclus
Destination
Disponibilité Envoi sous 5 à 7 jours ouvrables

Description du produit

ID gène 51703
Immunogène ACSL5 (NP_057318, 91 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSD NGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS*
Isotype IgG1 kappa  (Anticorps secondaires correspondants)
Clone 5H8
Description Acyl-CoA synthetase long-chain family member 5 The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant ACSL5. Synonyms: ACS2, ACS5, FACL5

Applications

Indications d'application Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.67 KDa) .
Stock Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Alternatives

Alternatives pour l'antigen "Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5)", Type "Anticorps"
Hôtes Lapin (8), Chèvre (7), Souris (5)
Reactivités Humain (18), Souris (2), Poulet (1), Boeuf (Vache) (1), Chien (1), Porc (1), Rat (Rattus) (1)
Applications Transfer Western (WB) (17), Enzyme Immunoassay (EIA) (7), Immunohistochimie (Coupes en paraffine) (IHC (p)) (7), ELISA (6), ELISA (Detection) (2), Dot Blot (Dot) (1), Immunohistochimie (IHC) (1), Immunoprécipitation (IP) (1)
Epitopes N-Term (2), C-Term (1)