GZMA anticorps
Aperçu rapide pour GZMA anticorps (ABIN634499)
Antigène
Voir toutes GZMA AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS
-
-
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) antibody
GZMA Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (AA 29-262) antibodyGZMA Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (full length) antibodyGZMA Reactivité: Humain IP, ICC, FACS Hôte: Souris Monoclonal CB9 unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) antibody (Alexa Fluor 594)GZMA Reactivité: Humain FACS Hôte: Souris Monoclonal CB9 Alexa Fluor 594
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (Center) antibodyGZMA Reactivité: Humain, Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (AA 41-141) antibodyGZMA Reactivité: Humain ELISA Hôte: Souris Monoclonal 4C6 unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (C-Term) antibodyGZMA Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (AA 101-200) antibodyGZMA Reactivité: Humain, Souris WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (AA 29-260) antibodyGZMA Reactivité: Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) (AA 29-262) antibodyGZMA Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
Granzyme A Blocking Peptide, (ABIN5613853), is also available for use as a blocking control in assays to test for specificity of this Granzyme A antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMA antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))
-
Autre désignation
- Granzyme A
-
Sujet
- Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.
-
Poids moléculaire
- 26 kDa (MW of target protein)
-
Pathways
- Apoptose
Antigène
-
