Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) anticorps
Aperçu rapide pour Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) anticorps (ABIN635267)
Antigène
Voir toutes Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- SLC17 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
-
-
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (AA 479-492), (Intracellular) antibody
SLC17A5 Reactivité: Souris WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (N-Term) antibodySLC17A5 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Mouton, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (AA 201-300) antibodySLC17A5 Reactivité: Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (AA 85-99) antibodyVerified SLC17A5 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (AA 151-200) antibodySLC17A5 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Singe, Roussette (Chauve-souris), Poulet, Hamster, Xenopus laevis WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) (AA 146-405) antibodySLC17A5 Reactivité: Humain WB, IHC, IF/ICC, IP Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
SLC17A5 Blocking Peptide, (ABIN940337), is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
-
Autre désignation
- SLC17A5
-
Sujet
- SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
-
Poids moléculaire
- 55 kDa (MW of target protein)
Antigène
-
