TSG101 anticorps (C-Term)
-
- Antigène Voir toutes TSG101 Anticorps
- TSG101 (Tumor Susceptibility Gene 101 (TSG101))
-
Épitope
- AA 361-390, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSG101 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human,Rat.
- Séquence
- KHVRLLSRKQ FQLRALMQKA RKTAGLSDLY
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human,Rat.
Gene Name: tumor susceptibility 101
Protein Name: Tumor susceptibility gene 101 protein - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product TSG101 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- TSG101 (Tumor Susceptibility Gene 101 (TSG101))
- Autre désignation
- TSG101 (TSG101 Produits)
- Synonymes
- anticorps CG9712, anticorps DmTSG101, anticorps Dmel\\CG9712, anticorps ESCRT-I, anticorps Tsg101, anticorps burs, anticorps dTSg101, anticorps dTsg101, anticorps dVps23, anticorps ept, anticorps tsg101, anticorps vps23, anticorps TSG101, anticorps MGC76193, anticorps TSG10, anticorps VPS23, anticorps AI255943, anticorps CC2, anticorps Rw, anticorps zgc:86926, anticorps tumor susceptibility 101, anticorps Tumor susceptibility gene 101, anticorps Tumor Susceptibility Gene homolog, anticorps tumor susceptibility gene 101, anticorps tumor susceptibility 101a, anticorps tumor susceptibility 101 L homeolog, anticorps TSG101, anticorps tsg-101, anticorps tsg101, anticorps Tsg101, anticorps tsg101a, anticorps tsg101.L
- Sujet
-
TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Synonyms: ESCRT I complex subunit TSG101 antibody|ESCRT-I complex subunit TSG101 antibody|TS101_HUMAN antibody|TSG 10 antibody|TSG 101 antibody||TSG10 antibody|Tsg101 antibody|Tumor susceptibility gene 10 antibody|Tumor susceptibility gene 101 antibody|Tumor susceptibility gene 101 protein antibody|Tumor susceptibility protein antibody|Tumor susceptibility protein isoform 3 antibody|VPS 23 antibody|VPS23 antibody - ID gène
- 7251
- UniProt
- Q99816
-