Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Cytokeratin 19 anticorps (C-Term)

KRT19 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043288
  • Antigène Voir toutes Cytokeratin 19 (KRT19) Anticorps
    Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
    Épitope
    • 21
    • 16
    • 16
    • 10
    • 8
    • 7
    • 6
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 334-372, C-Term
    Reactivité
    • 265
    • 90
    • 72
    • 8
    • 7
    • 7
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 139
    • 135
    • 3
    • 2
    • 1
    Lapin
    Clonalité
    • 148
    • 132
    Polyclonal
    Conjugué
    • 126
    • 33
    • 20
    • 13
    • 7
    • 6
    • 6
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    Cet anticorp Cytokeratin 19 est non-conjugé
    Application
    • 193
    • 97
    • 87
    • 82
    • 69
    • 48
    • 40
    • 39
    • 33
    • 31
    • 24
    • 23
    • 7
    • 6
    • 6
    • 5
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    QLAHIQALIS GIEAQLGDVR ADSERQNQEY QRLMDIKSR
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: keratin 19
    Protein Name: Keratin, type I cytoskeletal 19
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product KRT19 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Quan, Du, Hou, Wang, Zhang: "Utilization of E-cadherin by monocytes from tumour cells plays key roles in the progression of bone invasion by oral squamous cell carcinoma." dans: Oncology reports, Vol. 38, Issue 2, pp. 850-858, (2017) (PubMed).

    Jeng, Jeng, Jeng, Sheen, Li, Lu, Chang: "Tropism of liver epithelial cells toward hepatocellular carcinoma in vitro and in vivo with altering gene expression of cancer stem cells." dans: American journal of surgery, Vol. 215, Issue 4, pp. 735-743, (2017) (PubMed).

    Li, Zhang, Zhang, Liu, Qi, Zhao, Jiang, Zhai, Ji, Luo: "Stem cell-like circulating tumor cells indicate poor prognosis in gastric cancer." dans: BioMed research international, Vol. 2014, pp. 981261, (2015) (PubMed).

    Yin, Tian, Ye, Li, Wang, Cheng, Chen, Guo, Huang: "Nanog and ?-catenin: a new convergence point in EpSC proliferation and differentiation." dans: International journal of molecular medicine, Vol. 29, Issue 4, pp. 587-92, (2012) (PubMed).

    Lu, Gu, Xu, Liu, Xie, Song: "Adult islets cultured in collagen gel transdifferentiate into duct-like cells." dans: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3426-30, (2005) (PubMed).

  • Antigène
    Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
    Autre désignation
    KRT19 (KRT19 Produits)
    Synonymes
    anticorps CK19, anticorps K19, anticorps K1CS, anticorps AI663979, anticorps EndoC, anticorps Krt-1.19, anticorps Krt1-19, anticorps Ka19, anticorps k19, anticorps ck19, anticorps k1cs, anticorps krt9, anticorps krt15, anticorps MGC76282, anticorps GK-19, anticorps MGC83069, anticorps KRT19, anticorps keratin 19, anticorps keratin 19 L homeolog, anticorps keratin, type I cytoskeletal 19, anticorps KRT19, anticorps Krt19, anticorps krt19, anticorps krt19.L, anticorps LOC100344434, anticorps LOC101117946
    Sujet
    Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

    Synonyms: 40 kDa keratin intermediate filament antibody|CK 19 antibody|CK-19 antibody|ck19 antibody| Cytokeratin 19 antibody|Cytokeratin-19 antibody|k19 antibody|K1C19_HUMAN antibody|k1cs antibody|Keratin 19 antibody|Keratin type I 40 kD antibody|Keratin type i 40kD antibody| Keratin type I cytoskeletal 19 antibody|Keratin, type I cytoskeletal 19 antibody|Keratin, type I, 40 kd antibody|Keratin-19 antibody|krt19 antibody|mgc15366 antibody
    ID gène
    3880
    UniProt
    P08727
Vous êtes ici:
Support technique