PIGR anticorps (C-Term)

N° du produit ABIN3043380

Détail du produit anti-PIGR anticorps

Antigène: PIGR (Polymeric Immunoglobulin Receptor (PIGR))

Épitope: AA 579-613, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGR est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor(PIGR) detection. Tested with WB in Human.

Séquence: DAAPDEKVLD SGFREIENKA IQDPRLFAEE KAVAD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor(PIGR) detection. Tested with WB in Human.
Gene Name: polymeric immunoglobulin receptor
Protein Name: Polymeric immunoglobulin receptor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PIGR

Antigène: PIGR (Polymeric Immunoglobulin Receptor (PIGR))

Autre désignation: PIGR (PIGR Produits)

Synonymes: anticorps DKFZp469G1013, anticorps RNPIGR2, anticorps pIgA-R, anticorps polymeric immunoglobulin receptor, anticorps PIGR, anticorps Pigr

Sujet: Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells, the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.

Synonyms: Hepatocellular carcinoma associated protein TB6 antibody|Hepatocellular carcinoma-associated protein TB6 antibody|MGC125361 antibody| MGC125362 antibody|Phosphatidylinositol glycan, class R antibody|PIGR antibody|PIGR_HUMAN antibody|Poly Ig receptor antibody|Poly-Ig receptor antibody|Polymeric immunoglobulin receptor antibody|Secretory component antibody|Transmembrane secretory component antibody

ID gène: 5284

UniProt: P01833