MMP10 anticorps (C-Term)

N° du produit ABIN3043406

Détail du produit anti-MMP10 anticorps

Antigène: MMP10 (Matrix Metallopeptidase 10 (Stromelysin 2) (MMP10))

Épitope: AA 409-443, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP10 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Stromelysin-2(MMP10) detection. Tested with WB in Human.

Séquence: RFDENSQSME QGFPRLIADD FPGVEPKVDA VLQAF

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Stromelysin-2(MMP10) detection. Tested with WB in Human.
Gene Name: matrix metallopeptidase 10 (stromelysin 2)
Protein Name: Stromelysin-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MMP10 (409-443aa RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF), different from the related mouse sequence by twelve amino acids, and from the related rat sequence by nine amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MMP10

Antigène: MMP10 (Matrix Metallopeptidase 10 (Stromelysin 2) (MMP10))

Autre désignation: MMP10 (MMP10 Produits)

Synonymes: anticorps SL-2, anticorps STMY2, anticorps AV377895, anticorps MMP-10, anticorps matrix metallopeptidase 10, anticorps MMP10, anticorps Mmp10

Sujet: Stromelysin-2 also known as matrix metalloproteinase-10 (MMP-10) or transin-2 is an enzyme that in humans is encoded by the MMP10 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

Synonyms: Matrix metallopeptidase 10 (stromelysin 2) antibody|Matrix metalloprotease 10 antibody| Matrix metalloproteinase 10 (stromelysin 2) antibody|Matrix metalloproteinase 10 antibody| Matrix metalloproteinase-10 antibody|MMP 10 antibody|MMP-10 antibody|Mmp10 antibody| MMP10_HUMAN antibody|SL 2 antibody|SL-2 antibody|SL2 antibody|STMY 2 antibody|STMY2 antibody|Stromelysin 2 antibody|Stromelysin II antibody|Stromelysin-2 antibody|Stromelysin2 antibody|StromelysinII antibody|Transin 2 antibody|Transin-2 antibody|Transin2 antibody

ID gène: 4319

UniProt: P09238