PPP1R12A anticorps (N-Term)

N° du produit ABIN3043902

Détail du produit anti-PPP1R12A anticorps

Antigène: PPP1R12A (Myosin Phosphatase, Target Subunit 1 (PPP1R12A))

Épitope: AA 1-40, N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R12A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human,Mouse.

Séquence: MKMADAKQKR NEQLKRWIGS ETDLEPPVVK RQKTKVKFDD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: protein phosphatase 1, regulatory subunit 12A
Protein Name: Protein phosphatase 1 regulatory subunit 12A

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-PPP1R12A (ABIN3043902)

Yan, Wang, Jiang, Chen, He, Mang, Shao, Xu: "The role of Rho/Rho-kinase pathway and the neuroprotective effects of fasudil in chronic cerebral ischemia." dans: Neural regeneration research, Vol. 10, Issue 9, pp. 1441-9, (2015) (PubMed).

Détails sur PPP1R12A

Antigène: PPP1R12A (Myosin Phosphatase, Target Subunit 1 (PPP1R12A))

Autre désignation: PPP1R12A (PPP1R12A Produits)

Synonymes: anticorps 1200015F06Rik, anticorps 5730577I22Rik, anticorps AA792106, anticorps AV099298, anticorps D10Ertd625e, anticorps Mypt1, anticorps M130, anticorps MBS, anticorps MYPT1, anticorps M110, anticorps MBSP, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 12A, anticorps protein phosphatase 1 regulatory subunit 12A, anticorps protein phosphatase 1, regulatory subunit 12A, anticorps Ppp1r12a, anticorps PPP1R12A

Sujet: PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.

Synonyms: M130 antibody|MBS antibody|MGC133042 antibody|Myosin binding subunit antibody|Myosin phosphatase target subunit 1 antibody|Myosin phosphatase targeting subunit 1 antibody| Myosin phosphatase-targeting subunit 1 antibody|MYPT 1 antibody|MYPT1 antibody|MYPT1_HUMAN antibody|PPP1R12A antibody|Protein phosphatase 1 regulatory inhibitor subunit 12A antibody| Protein phosphatase 1 regulatory subunit 12A antibody|Protein phosphatase 1, regulatory (inhibitor) subunit 12A antibody|Protein phosphatase myosin binding subunit antibody| Protein phosphatase myosin-binding subunit antibody

ID gène: 4659

UniProt: O14974

Pathways: M Phase