UBE2Q2 anticorps (N-Term)

N° du produit ABIN3043953

Détail du produit anti-UBE2Q2 anticorps

Antigène: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Épitope: AA 83-123, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2Q2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Ubiquitin-conjugating enzyme E2 Q2(UBE2Q2) detection. Tested with WB, IHC-P in Human.

Séquence: LERLEDTKNN NLLRQQLKWL ICELCSLYNL PKHLDVEMLD Q

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ubiquitin-conjugating enzyme E2 Q2(UBE2Q2) detection. Tested with WB, IHC-P in Human.
Gene Name: ubiquitin conjugating enzyme E2Q family member 2
Protein Name: Ubiquitin-conjugating enzyme E2 Q2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur UBE2Q2

Antigène: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Autre désignation: UBE2Q2 (UBE2Q2 Produits)

Synonymes: anticorps 3010021M21Rik, anticorps zgc:56219, anticorps wu:fi34a03, anticorps RGD1307680, anticorps ube2q2, anticorps ubiquitin conjugating enzyme E2 Q2, anticorps ubiquitin-conjugating enzyme E2Q family member 2, anticorps ubiquitin-conjugating enzyme E2 Q2, anticorps ubiquitin conjugating enzyme E2Q family member 2 L homeolog, anticorps UBE2Q2, anticorps Ube2q2, anticorps CpipJ_CPIJ007726, anticorps PTRG_02494, anticorps MGYG_01328, anticorps ube2q2, anticorps ube2q2.L

Sujet: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. UBE2Q2 can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.

Synonyms: LOC92912 antibody|UB2Q2_HUMAN antibody|UBE2Q2 antibody|Ubiquitin carrier protein Q2 antibody|Ubiquitin conjugating enzyme E2Q 2 antibody|Ubiquitin conjugating enzyme E2Q family member 2 antibody|Ubiquitin-conjugating enzyme E2 Q2 antibody|ubiquitin-conjugating enzyme E2Q (putative) 2 antibody|Ubiquitin-protein ligase Q2 antibody

ID gène: 92912