KIAA0430 (KIAA0430) anticorps

Détails pour le produit réf. ABIN4331202, Fournisseur: Connectez-vous pour afficher
Antigène
  • LKAP
  • MARF1
  • PPP1R34
  • 4921513D23Rik
  • BC031575
  • C87306
  • E030019O05
  • Lkap
  • mKIAA0430
  • KIAA0430
  • meiosis arrest female 1
  • KIAA0430
  • Marf1
Reactivité
Humain
5
2
1
Hôte
Lapin
3
2
Clonalité
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
5
2
Options
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PPVCLKGSLYCEDCLNKPARNSIIDAAKVWPNIPPPNTQPAPLAVPLCNGCGTKGTGKETTLLLATSLGKAASKFGSPEVAVAGQVLENLPPIGVFWDIENCSVPSGRSATAVVQRIREKFFKGHREAEFICVCDISKENKE
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Autre désignation LKAP (KIAA0430 Antibody Extrait)
Sujet Gene Symbol: KIAA0430
ID gène 9665
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-KIAA0430 (KIAA0430) antibody (ABIN4331202) Immunohistochemistry: LKAP Antibody [NBP1-87854] - Staining of human duodenum shows c...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-KIAA0430 (KIAA0430) antibody (ABIN4331202) Immunohistochemistry-Paraffin: LKAP Antibody - Staining of human duodenum shows stro...
Immunofluorescence (IF) image for anti-KIAA0430 (KIAA0430) antibody (ABIN4331202) Immunocytochemistry/Immunofluorescence: LKAP Antibody - Immunofluorescent staining o...