RNASEH2A anticorps (Middle Region)

N° du produit ABIN630199

Détail du produit anti-RNASEH2A anticorps

Antigène: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Épitope: Middle Region

Reactivité: Humain, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNASEH2A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RNASEH2 A antibody was raised against the middle region of RNASEH2

Purification: Purified

Immunogène: RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASEH2A Blocking Peptide, catalog no. 33R-1458, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNASEH2A

Antigène: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Autre désignation: RNASEH2A (RNASEH2A Produits)

Synonymes: anticorps 2400006P09Rik, anticorps RNASEHI, anticorps RNHIA, anticorps RNHL, anticorps zgc:56307, anticorps AGS4, anticorps JUNB, anticorps ribonuclease H2 subunit A, anticorps ribonuclease H2, large subunit, anticorps ribonuclease H2, subunit A, anticorps ribonuclease H2 subunit A L homeolog, anticorps rnaseh2a, anticorps RNASEH2A, anticorps Rnaseh2a, anticorps rnaseh2a.L

Sujet: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Poids moléculaire: 33 kDa (MW of target protein)