RNF125 anticorps (Middle Region)
-
- Antigène Voir toutes RNF125 Anticorps
- RNF125 (Ring Finger Protein 125 (RNF125))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF125 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF125 antibody was raised against the middle region of RNF125
- Purification
- Affinity purified
- Immunogène
- RNF125 antibody was raised using the middle region of RNF125 corresponding to a region with amino acids ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH
- Top Product
- Discover our top product RNF125 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF125 Blocking Peptide, catalog no. 33R-2614, is also available for use as a blocking control in assays to test for specificity of this RNF125 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF125 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF125 (Ring Finger Protein 125 (RNF125))
- Autre désignation
- RNF125 (RNF125 Produits)
- Synonymes
- anticorps 4930553F04Rik, anticorps TRAC-1, anticorps TRAC1, anticorps ring finger protein 125, anticorps RNF125, anticorps Rnf125
- Sujet
- This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
- Poids moléculaire
- 26 kDa (MW of target protein)
-