BLMH anticorps (Middle Region)

N° du produit ABIN631453

Détail du produit anti-BLMH anticorps

Antigène: BLMH (Bleomycin Hydrolase (BLMH))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BLMH est non-conjugé

Application: Western Blotting (WB)

Specificité: BLMH antibody was raised against the middle region of BLMH

Purification: Affinity purified

Immunogène: BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BLMH Blocking Peptide, catalog no. 33R-2825, is also available for use as a blocking control in assays to test for specificity of this BLMH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BLMH

Antigène: BLMH (Bleomycin Hydrolase (BLMH))

Autre désignation: BLMH (BLMH Produits)

Synonymes: anticorps AI035728, anticorps Bh, anticorps Bmh, anticorps wu:fb13c01, anticorps zgc:66261, anticorps bh, anticorps bmh, anticorps BH, anticorps BMH, anticorps bleomycin hydrolase, anticorps Bleomycin hydrolase, anticorps bleomycin hydrolase S homeolog, anticorps BLMH, anticorps pepC, anticorps LOC5569945, anticorps Apre_0140, anticorps Apar_0899, anticorps Smon_1289, anticorps Kfla_1242, anticorps Snas_3912, anticorps BLJ_1941, anticorps Olsu_1085, anticorps PGTDC60_0106, anticorps Blmh, anticorps blmh, anticorps blmh.S

Sujet: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.

Poids moléculaire: 52 kDa (MW of target protein)