MAB21L1 anticorps

N° du produit ABIN631621

Détail du produit anti-MAB21L1 anticorps

Antigène: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAB21L1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MAB21 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAB21L1 Blocking Peptide, catalog no. 33R-3887, is also available for use as a blocking control in assays to test for specificity of this MAB21L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAB20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAB21L1

Antigène: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Autre désignation: MAB21L1 (MAB21L1 Produits)

Synonymes: anticorps MGC145860, anticorps cagr1, anticorps CAGR1, anticorps AW047968, anticorps mab-21-like 1, anticorps mab-21-like 1 L homeolog, anticorps mab-21 like 1, anticorps mab-21-like 1 (C. elegans), anticorps mab21l1, anticorps mab21l1.L, anticorps MAB21L1, anticorps Mab21l1

Sujet: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.

Poids moléculaire: 41 kDa (MW of target protein)