UBE2E1 anticorps

N° du produit ABIN631662

Détail du produit anti-UBE2E1 anticorps

Antigène: UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))

Reactivité: Humain, Souris, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2E1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UBE2 E1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2E1 Blocking Peptide, catalog no. 33R-7168, is also available for use as a blocking control in assays to test for specificity of this UBE2E1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2E1

Antigène: UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))

Autre désignation: UBE2E1 (UBE2E1 Produits)

Synonymes: anticorps ubch6, anticorps UBCH6, anticorps UbcM3, anticorps Ubce5, anticorps ubcM2, anticorps ubiquitin conjugating enzyme E2 E1, anticorps ubiquitin-conjugating enzyme E2 E1, anticorps ubiquitin-conjugating enzyme E2E 1, anticorps ubiquitin conjugating enzyme E2 E1 L homeolog, anticorps ube2e1, anticorps UBE2E1, anticorps LOC100354960, anticorps LOC100362535, anticorps Ube2e1, anticorps ube2e1.L

Sujet: UBE2E1 catalyzes the covalent attachment of ubiquitin to other proteins. UBE2E1 mediates the selective degradation of short-lived and abnormal proteins.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway