GORASP1 anticorps (N-Term)

N° du produit ABIN632290

Détail du produit anti-GORASP1 anticorps

Antigène: GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GORASP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GORASP1 antibody was raised against the N terminal of GORASP1

Purification: Affinity purified

Immunogène: GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GORASP1 Blocking Peptide, catalog no. 33R-7444, is also available for use as a blocking control in assays to test for specificity of this GORASP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GORASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GORASP1

Antigène: GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))

Autre désignation: GORASP1 (GORASP1 Produits)

Synonymes: anticorps MGC69226, anticorps MGC134531, anticorps 5430411C10Rik, anticorps GOLPH5, anticorps GRASP65, anticorps P65, anticorps cb744, anticorps zgc:101588, anticorps golgi reassembly stacking protein 1, anticorps golgi perepheral membrane protein p65, anticorps golgi reassembly stacking protein 1a, anticorps GORASP1, anticorps gorasp1, anticorps PTRG_03298, anticorps PY00200, anticorps Gorasp1, anticorps gorasp1a

Sujet: The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome