LRP2BP anticorps (Middle Region)

N° du produit ABIN632431

Détail du produit anti-LRP2BP anticorps

Antigène: LRP2BP (LRP2 Binding Protein (LRP2BP))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRP2BP est non-conjugé

Application: Western Blotting (WB)

Specificité: LRP2 BP antibody was raised against the middle region of LRP2 P

Purification: Affinity purified

Immunogène: LRP2 BP antibody was raised using the middle region of LRP2 P corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRP2BP Blocking Peptide, catalog no. 33R-8200, is also available for use as a blocking control in assays to test for specificity of this LRP2BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRP2BP

Antigène: LRP2BP (LRP2 Binding Protein (LRP2BP))

Autre désignation: LRP2BP (LRP2BP Produits)

Synonymes: anticorps 1700113N17Rik, anticorps 2310006J04Rik, anticorps 4930479L12Rik, anticorps MegBP, anticorps RGD1305896, anticorps LRP2BP, anticorps zgc:165631, anticorps LRP2 binding protein, anticorps Lrp2 binding protein, anticorps LRP2 binding protein S homeolog, anticorps LRP2BP, anticorps Lrp2bp, anticorps lrp2bp, anticorps lrp2bp.S

Sujet: LRP2BP may act as an adapter that regulates LRP2 function.

Poids moléculaire: 38 kDa (MW of target protein)