ACOT2 anticorps (Middle Region)
-
- Antigène Voir toutes ACOT2 Anticorps
- ACOT2 (Acyl-CoA Thioesterase 2 (ACOT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACOT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACOT2 antibody was raised against the middle region of ACOT2
- Purification
- Affinity purified
- Immunogène
- ACOT2 antibody was raised using the middle region of ACOT2 corresponding to a region with amino acids SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR
- Top Product
- Discover our top product ACOT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACOT2 Blocking Peptide, catalog no. 33R-8680, is also available for use as a blocking control in assays to test for specificity of this ACOT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACOT2 (Acyl-CoA Thioesterase 2 (ACOT2))
- Autre désignation
- ACOT2 (ACOT2 Produits)
- Synonymes
- anticorps MGC83099, anticorps CTE-IA, anticorps CTE1A, anticorps MTE1, anticorps PTE2, anticorps PTE2A, anticorps ZAP128, anticorps AA571646, anticorps MTE-I, anticorps Mte1, anticorps acyl-CoA thioesterase 2 S homeolog, anticorps acyl-CoA thioesterase 2, anticorps acyl-coenzyme A thioesterase 1, anticorps acot2.S, anticorps ACOT2, anticorps LOC490770, anticorps acot2, anticorps LOC100344509, anticorps Acot2
- Sujet
- Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-