GAN anticorps (Middle Region)
-
- Antigène Voir toutes GAN Anticorps
- GAN (Gigaxonin (GAN))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GAN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GAN antibody was raised against the middle region of GAN
- Purification
- Affinity purified
- Immunogène
- GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
- Top Product
- Discover our top product GAN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GAN Blocking Peptide, catalog no. 33R-4223, is also available for use as a blocking control in assays to test for specificity of this GAN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GAN (Gigaxonin (GAN))
- Autre désignation
- GAN (GAN Produits)
- Synonymes
- anticorps MGC81691, anticorps GAN, anticorps A330045G18, anticorps gigaxonin, anticorps GAN1, anticorps KLHL16, anticorps gigaxonin L homeolog, anticorps gigaxonin, anticorps giant axonal neuropathy, anticorps gan.L, anticorps gan, anticorps GAN, anticorps Gan
- Sujet
- This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).
- Poids moléculaire
- 66 kDa (MW of target protein)
-