ZDHHC21 anticorps (Middle Region)

N° du produit ABIN633123

Détail du produit anti-ZDHHC21 anticorps

Antigène: ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC21 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZDHHC21 antibody was raised against the middle region of ZDHHC21

Purification: Affinity purified

Immunogène: ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC21 Blocking Peptide, catalog no. 33R-2559, is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC21

Antigène: ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))

Autre désignation: ZDHHC21 (ZDHHC21 Produits)

Synonymes: anticorps 9130404H11Rik, anticorps AL024349, anticorps D130004H04Rik, anticorps dep, anticorps DHHC-21, anticorps DHHC21, anticorps DNZ1, anticorps HSPC097, anticorps zinc finger DHHC-type containing 21, anticorps zinc finger, DHHC domain containing 21, anticorps zinc finger, DHHC-type containing 21, anticorps ZDHHC21, anticorps zdhhc21, anticorps Zdhhc21

Sujet: The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)