ADAMTS18 anticorps (N-Term)

N° du produit ABIN633175

Détail du produit anti-ADAMTS18 anticorps

Antigène: ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAMTS18 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADAMTS18 antibody was raised against the N terminal of ADAMTS18

Purification: Affinity purified

Immunogène: ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAMTS18 Blocking Peptide, catalog no. 33R-3140, is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAMTS18

Antigène: ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))

Autre désignation: ADAMTS18 (ADAMTS18 Produits)

Synonymes: anticorps 9630038L21, anticorps ADAMTS21, anticorps E130314N14Rik, anticorps KNO2, anticorps RGD1560118, anticorps a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 18, anticorps ADAM metallopeptidase with thrombospondin type 1 motif 18, anticorps ADAM metallopeptidase with thrombospondin type 1 motif, 18, anticorps Adamts18, anticorps ADAMTS18

Sujet: ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.

Poids moléculaire: 104 kDa (MW of target protein)