SLIRP anticorps (N-Term)

N° du produit ABIN633258

Détail du produit anti-SLIRP anticorps

Antigène: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLIRP est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF156 antibody was raised against the N terminal Of C14 rf156

Purification: Affinity purified

Immunogène: C14 ORF156 antibody was raised using the N terminal Of C14 rf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF156 Blocking Peptide, catalog no. 33R-7071, is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF156 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLIRP

Antigène: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Autre désignation: C14ORF156 (SLIRP Produits)

Synonymes: anticorps C14orf156, anticorps SLIRP, anticorps DKFZp468C196, anticorps DC50, anticorps PD04872, anticorps 1810035L17Rik, anticorps C10H14orf156, anticorps SRA stem-loop interacting RNA binding protein, anticorps Slirp, anticorps C14orf156, anticorps SLIRP

Sujet: As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

Poids moléculaire: 12 kDa (MW of target protein)