RPS7 anticorps (Middle Region)

N° du produit ABIN633563

Détail du produit anti-RPS7 anticorps

Antigène: RPS7 (Ribosomal Protein S7 (RPS7))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS7 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS7 antibody was raised against the middle region of RPS7

Purification: Affinity purified

Immunogène: RPS7 antibody was raised using the middle region of RPS7 corresponding to a region with amino acids RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS7 Blocking Peptide, catalog no. 33R-7979, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS7

Antigène: RPS7 (Ribosomal Protein S7 (RPS7))

Autre désignation: RPS7 (RPS7 Produits)

Synonymes: anticorps CG1883, anticorps Dmel\\CG1883, anticorps DBA8, anticorps S7, anticorps Mtu, anticorps Rps7A, anticorps zgc:73216, anticorps dba8, anticorps rpS8B, anticorps rpS8A, anticorps Ribosomal protein S7, anticorps 30S ribosomal protein S7, anticorps 40S ribosomal protein S7, anticorps ribosomal protein S7, anticorps ribosomal protein S7 S homeolog, anticorps ribosomal protein S8, anticorps RpS7, anticorps rps7, anticorps rps-7, anticorps RPS7, anticorps Rps7, anticorps rps7.S

Sujet: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Tube Formation