KCNA7 anticorps (C-Term)
-
- Antigène Voir toutes KCNA7 Anticorps
- KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNA7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNA7 antibody was raised against the C terminal of KCNA7
- Purification
- Affinity purified
- Immunogène
- KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV
- Top Product
- Discover our top product KCNA7 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNA7 Blocking Peptide, catalog no. 33R-3222, is also available for use as a blocking control in assays to test for specificity of this KCNA7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))
- Autre désignation
- KCNA7 (KCNA7 Produits)
- Sujet
- Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
- Poids moléculaire
- 50 kDa (MW of target protein)
-