Fibulin 1 anticorps (N-Term)

N° du produit ABIN633929

Détail du produit anti-Fibulin 1 anticorps

Antigène: Fibulin 1 (FBLN1)

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fibulin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBLN1 antibody was raised against the N terminal of FBLN1

Purification: Affinity purified

Immunogène: FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBLN1 Blocking Peptide, catalog no. 33R-1657, is also available for use as a blocking control in assays to test for specificity of this FBLN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fibulin 1

Antigène: Fibulin 1 (FBLN1)

Autre désignation: FBLN1 (FBLN1 Produits)

Synonymes: anticorps fbln1, anticorps FBLN, anticorps FIBL1, anticorps fbln1c, anticorps fbln1d, anticorps wu:fc52c06, anticorps MGC115035, anticorps fibulin 1, anticorps fibulin 1 L homeolog, anticorps FBLN1, anticorps fbln1, anticorps Fbln1, anticorps fbln1.L, anticorps CpipJ_CPIJ017419

Sujet: Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen.

Poids moléculaire: 72 kDa (MW of target protein)