RHOBTB1 anticorps (Middle Region)

N° du produit ABIN634415

Détail du produit anti-RHOBTB1 anticorps

Antigène: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOBTB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RHOBTB1 antibody was raised against the middle region of RHOBTB1

Purification: Affinity purified

Immunogène: RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOBTB1 Blocking Peptide, catalog no. 33R-2087, is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOBTB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOBTB1

Antigène: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Autre désignation: RHOBTB1 (RHOBTB1 Produits)

Synonymes: anticorps 1700008H16Rik, anticorps 3110048G13Rik, anticorps AI173445, anticorps AI573858, anticorps AV350930, anticorps Rho related BTB domain containing 1, anticorps Rho-related BTB domain containing 1, anticorps Rho related BTB domain containing 1 S homeolog, anticorps RHOBTB1, anticorps rhobtb1, anticorps rhobtb1.S, anticorps Rhobtb1

Sujet: RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.

Poids moléculaire: 77 kDa (MW of target protein)