LPCAT1 anticorps (Middle Region)
-
- Antigène Voir toutes LPCAT1 Anticorps
- LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LPCAT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LPCAT1 antibody was raised against the middle region of LPCAT1
- Purification
- Affinity purified
- Immunogène
- LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF
- Top Product
- Discover our top product LPCAT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LPCAT1 Blocking Peptide, catalog no. 33R-5370, is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))
- Autre désignation
- LPCAT1 (LPCAT1 Produits)
- Sujet
- Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.
- Poids moléculaire
- 59 kDa (MW of target protein)
-