RNF182 anticorps (Middle Region)
-
- Antigène Voir toutes RNF182 Anticorps
- RNF182 (Ring Finger Protein 182 (RNF182))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF182 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF182 antibody was raised against the middle region of RNF182
- Purification
- Affinity purified
- Immunogène
- RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
- Top Product
- Discover our top product RNF182 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF182 Blocking Peptide, catalog no. 33R-5457, is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF182 (Ring Finger Protein 182 (RNF182))
- Autre désignation
- RNF182 (RNF182 Produits)
- Synonymes
- anticorps C630023L15Rik, anticorps RGD1560399, anticorps ring finger protein 182, anticorps ring finger protein 182 L homeolog, anticorps RNF182, anticorps Rnf182, anticorps rnf182.L
- Sujet
- RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.
- Poids moléculaire
- 27 kDa (MW of target protein)
-