FAM3C anticorps (C-Term)

N° du produit ABIN635303

Détail du produit anti-FAM3C anticorps

Antigène: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM3C est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM3 C antibody was raised against the C terminal of FAM3

Purification: Affinity purified

Immunogène: FAM3 C antibody was raised using the C terminal of FAM3 corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM3C Blocking Peptide, catalog no. 33R-2091, is also available for use as a blocking control in assays to test for specificity of this FAM3C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM3C

Antigène: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Autre désignation: FAM3C (FAM3C Produits)

Synonymes: anticorps ILEI, anticorps D6Wsu176e, anticorps Ilei, anticorps wu:fb99h11, anticorps wu:fi35h03, anticorps zgc:55444, anticorps zgc:77090, anticorps family with sequence similarity 3 member C, anticorps family with sequence similarity 3, member C, anticorps family with sequence similarity 3 member C L homeolog, anticorps fam3c, anticorps FAM3C, anticorps Fam3c, anticorps fam3c.L

Sujet: FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.

Poids moléculaire: 22 kDa (MW of target protein)