B4GALT2 anticorps (Middle Region)
-
- Antigène Voir toutes B4GALT2 Anticorps
- B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 2 (B4GALT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B4GALT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- B4 GALT2 antibody was raised against the middle region of B4 ALT2
- Purification
- Affinity purified
- Immunogène
- B4 GALT2 antibody was raised using the middle region of B4 ALT2 corresponding to a region with amino acids AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
- Top Product
- Discover our top product B4GALT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B4GALT2 Blocking Peptide, catalog no. 33R-1236, is also available for use as a blocking control in assays to test for specificity of this B4GALT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 2 (B4GALT2))
- Autre désignation
- B4GALT2 (B4GALT2 Produits)
- Synonymes
- anticorps B4Gal-T2, anticorps B4Gal-T3, anticorps beta4Gal-T2, anticorps Ggtb2, anticorps b4gal-t1, anticorps b4galt2, anticorps beta4gal-t1, anticorps cdg2d, anticorps ggtb2, anticorps gt1, anticorps gtb, anticorps b4gal-t2, anticorps beta4gal-t2, anticorps b4Gal-T2, anticorps si:ch211-261p7.4, anticorps CKII, anticorps beta-1,4-galactosyltransferase 2, anticorps UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, anticorps UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1, gene 2, anticorps UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 S homeolog, anticorps B4GALT2, anticorps B4galt2, anticorps b4galt1.2, anticorps b4galt2.S, anticorps b4galt2
- Sujet
- This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-