B3GALT6 anticorps (C-Term)

N° du produit ABIN635815

Détail du produit anti-B3GALT6 anticorps

Antigène: B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GALT6 est non-conjugé

Application: Western Blotting (WB)

Specificité: B3 GALT6 antibody was raised against the C terminal of B3 ALT6

Purification: Affinity purified

Immunogène: B3 GALT6 antibody was raised using the C terminal of B3 ALT6 corresponding to a region with amino acids VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GALT6 Blocking Peptide, catalog no. 33R-9759, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GALT6

Antigène: B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))

Autre désignation: B3GALT6 (B3GALT6 Produits)

Synonymes: anticorps B3GALT6, anticorps MGC69183, anticorps Dyak\\GE22868, anticorps GE22868, anticorps beta3galt6, anticorps dyak_GLEANR_663, anticorps Dere\\GG10628, anticorps GG10628, anticorps dere_GLEANR_10535, anticorps Dper\\GL21178, anticorps GL21178, anticorps dper_GLEANR_3106, anticorps Dsec\\GM20673, anticorps GM20673, anticorps dsec_GLEANR_3487, anticorps Dpse\\GA28758, anticorps GA28758, anticorps dpse_GLEANR_8882, anticorps EDSP2, anticorps SEMDJL1, anticorps beta3GalT6, anticorps BB129894, anticorps GalTII, anticorps beta-1,3-galactosyltransferase 6, anticorps Beta-1,3-galactosyltransferase 6, anticorps UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6, anticorps UDP-Gal:betaGal beta 1,3-galactosyltransferase, polypeptide 6, anticorps B3GALT6, anticorps b3galt6, anticorps CpipJ_CPIJ010407, anticorps Dyak\beta3galt6, anticorps Dere\beta3galt6, anticorps Dper\beta3galt6, anticorps Dsec\beta3galt6, anticorps Dpse\beta3galt6, anticorps LOC100285906, anticorps B3galt6

Sujet: B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process