anti-Rat (Rattus) Metadherin anticorps pour Immunocytochemistry

Recommended Metadherin Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Metadherin (MTDH) Anticorps
  • MGC75963
  • 2610103J23Rik
  • 3D3
  • 3D3/Lyric
  • AEG-1
  • AV353288
  • D8Bwg1112e
  • Lyric
  • AEG1
  • LYRIC
  • LYRIC/3D3
  • metadherin
  • mtdh
  • MTDH
  • Mtdh
Reactivité
Humain, Souris, Rat (Rattus)
101
33
29
3
1
1
1
1
1
Hôte
Lapin
58
42
3
Clonalité
Polyclonal
Conjugué
Inconjugué
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
88
45
35
34
27
13
10
6
4
2
1
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4332036
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN2854801 ICC IF IHC (p) WB Rabbit IgG Center Connectez-vous pour afficher Polyclonal

General

Antigène Metadherin (MTDH) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(101), (33), (29), (3), (1), (1), (1), (1), (1)
Hôte Lapin
(58), (42), (3)
Clonalité
Polyclonal
Conjugué Inconjugué
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(88), (45), (35), (34), (27), (13), (10), (6), (4), (2), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Référence Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Référence Images Haut de la page
Antigène
Autre désignation LYRIC (MTDH Antibody Extrait)
Sujet Gene Symbol: MTDH
ID gène 92140
Domaine de recherche Microfilaments, Cytoskeleton, Cancer
Pathways Cellular Response to Molecule of Bacterial Origin, Cell-Cell Junction Organization

Information d'application

Détail du produit Détail du antigène Stockage Référence Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Référence Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Référence

Détail du produit Détail du antigène Information d'application Stockage Images Haut de la page
Produit citée dans:

Liu, Wu, Peng: "Astrocyte elevated gene-1 regulates osteosarcoma cell invasion and chemoresistance via endothelin-1/endothelin A receptor signaling." dans: Oncology letters, Vol. 5, Issue 2, pp. 505-510, 2013

Images

Détail du produit Détail du antigène Information d'application Stockage Référence Haut de la page
Supplier Images
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90328] - Staining of human cerebr...
Immunofluorescence (IF) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunocytochemistry/Immunofluorescence: LYRIC Antibody [NBP1-90328] - Staining of hum...