anti-Humain EPH Receptor A8 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended EPH Receptor A8 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
EPH Receptor A8 (EPHA8) Anticorps
  • TK
  • tke17-a
  • si:ch211-122l14.1
  • EPHA8
  • EEK
  • EK3
  • HEK3
  • AW047546
  • Eek
  • Hek3
  • mKIAA1459
  • EPH receptor A8
  • eph receptor A8
  • Eph receptor A8
  • epha8
  • EPHA8
  • Epha8
Reactivité
Humain
27
6
5
Hôte
Lapin
16
11
Clonalité
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
19
18
2
2
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4308693
418,75 €
Plus frais de livraison 40,00 € et TVA
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5623111 IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN5623112 IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal

General

Antigène EPH Receptor A8 (EPHA8) Anticorps
Reactivité Humain
(27), (6), (5)
Hôte Lapin
(16), (11)
Clonalité
Polyclonal
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(19), (18), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-EPH Receptor A8 anticorps

Détail du antigène EPH Receptor A8 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
Isotype IgG

Détail du antigène EPH Receptor A8

Détail du produit anti-EPH Receptor A8 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation EphA8 (EPHA8 Antibody Extrait)
Sujet Gene Symbol: EPHA8
ID gène 2046
Pathways Signalisation RTK

Information d'application

Détail du produit anti-EPH Receptor A8 anticorps Détail du antigène EPH Receptor A8 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-EPH Receptor A8 anticorps Détail du antigène EPH Receptor A8 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-EPH Receptor A8 anticorps Détail du antigène EPH Receptor A8 Information d'application Stockage Haut de la page
Supplier Images
Immunohistochemistry (IHC) image for anti-EPH Receptor A8 (EPHA8) antibody (ABIN4308693) Immunohistochemistry: EphA8 Antibody [NBP1-84893] - Staining of human small intestine...