ENO2/NSE anticorps (AA 2-285)
-
- Antigène Voir toutes ENO2/NSE (ENO2) Anticorps
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
-
Épitope
- AA 2-285
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ENO2/NSE est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Fonction
- Polyclonal Antibody to Enolase, Neuron Specific (NSE)
- Specificité
- The antibody is a rabbit polyclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.
- Réactivité croisée
- Souris, Rat
- Purification
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogène
- Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag
- Isotype
- IgG
- Top Product
- Discover our top product ENO2 Anticorps primaire
-
-
- Indications d'application
-
Western blotting: 0.5-2 μg/mL
Immunohistochemistry: 5-20 μg/mL
Immunocytochemistry: 5-20 μg/mL
Optimal working dilutions must be determined by end user.
- Commentaires
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.
- Agent conservateur
- ProClin
- Précaution d'utilisation
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Conseil sur la manipulation
- Avoid repeated freeze-thaw cycles.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Date de péremption
- 24 months
-
- Antigène
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Autre désignation
- Enolase, Neuron Specific (ENO2 Produits)
- Synonymes
- anticorps ENO2, anticorps DKFZp459B1817, anticorps NSE, anticorps AI837106, anticorps D6Ertd375e, anticorps Eno-2, anticorps RNEN3, anticorps eno3, anticorps wu:fc09h05, anticorps zgc:92418, anticorps enolase 2, anticorps enolase 2 (gamma, neuronal), anticorps enolase 2, gamma neuronal, anticorps enolase 2, gamma, neuronal, anticorps ENO2, anticorps Eno2, anticorps eno2
- Sujet
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
-