PTGER4 anticorps
-
- Antigène Voir toutes PTGER4 Anticorps
- PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTGER4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)
- Specificité
- Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.
- Réactivité croisée
- Souris, Rat (Rattus), Mouton
- Homologie
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%) Gibbon, Bovine (97%) Rabbit (93%) Marmoset (90%) Bat, Hamster, Elephant, Panda (87%) Horse (83%) Mouse, Rat (80%).
- Purification
- Affinity Purified
- Immunogène
- Human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI).
- Isotype
- IgG
- Top Product
- Discover our top product PTGER4 Anticorps primaire
-
-
- Indications d'application
- ICC, IHC-P (5 µg/mL), WB (1:200)
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- TBS, pH 7.4, 0.02% sodium azide, 0.5 mg/mL BSA, 50% glycerol.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- avoid freeze thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
-
- Antigène
- PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))
- Autre désignation
- PTGER4 / EP4 (PTGER4 Produits)
- Synonymes
- anticorps EP4, anticorps PGE2R-EP4, anticorps ptger4, anticorps ptger4l, anticorps PTGER4, anticorps EP4R, anticorps Ptgerep4, anticorps Ptger, anticorps ep4, anticorps prostaglandin E receptor 4, anticorps prostaglandin E receptor 4 (subtype EP4), anticorps prostaglandin E receptor 4 (subtype EP4) a, anticorps prostaglandin E receptor 4 subtype EP4, anticorps PTGER4, anticorps ptger4a, anticorps ptger4, anticorps Ptger4
- Sujet
- Standard Gene Symbol: PTGER4, Gene Family: GPCR, Gene Subfamily: Prostanoid, Synonyms: PTGER4, EP4, EP4 prostaglandin receptor, EP4R, PGE receptor EP4 subtype, Prostanoid EP4 receptor, Prostaglandin E receptor 4, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype
- ID gène
- 5734
- UniProt
- P35408
-