ATP2A1/SERCA1 anticorps (N-Term)

N° du produit ABIN3030066

Détail du produit anti-ATP2A1/SERCA1 anticorps

Antigène: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP2A1/SERCA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ATP2A1/SERCA1

Antigène: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Autre désignation: ATP2A1 (ATP2A1 Produits)

Synonymes: anticorps cb279, anticorps serca, anticorps serca1, anticorps wu:cegs655, anticorps wu:fb17h11, anticorps wu:fb19b10, anticorps zgc:92110, anticorps ATP2A1, anticorps atp2a, anticorps atp2a2, anticorps atp2b, anticorps ca-p60a, anticorps dar, anticorps serca2, anticorps SERCA1, anticorps ATP2A3, anticorps SERCA1a, anticorps Serca1, anticorps ATP2A, anticorps ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog, anticorps atp2a1, anticorps ATP2A1, anticorps atp2a2.S, anticorps Atp2a1

Sujet: SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

ID gène: 487

Pathways: Ribonucleoside Biosynthetic Process