ETV4 anticorps (N-Term)

N° du produit ABIN3042379

Détail du produit anti-ETV4 anticorps

Antigène: ETV4 (Ets Variant 4 (ETV4))

Épitope: AA 1-41, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ETV4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human,Rat.

Séquence: MERRMKAGYL DQQVPYTFSS KSPGNGSLRE ALIGPLGKLM D

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human,Rat.
Gene Name: ets variant 4
Protein Name: ETS translocation variant 4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ETV4

Antigène: ETV4 (Ets Variant 4 (ETV4))

Autre désignation: ETV4 (ETV4 Produits)

Synonymes: anticorps E1A-F, anticorps E1AF, anticorps PEA3, anticorps PEAS3, anticorps Pea3, anticorps AW414408, anticorps Pea-3, anticorps pea3, anticorps ETS variant 4, anticorps ets variant 4, anticorps ETV4, anticorps Etv4, anticorps etv4

Sujet: ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

Synonyms: Adenovirus E1A enhancer binding protein antibody|Adenovirus E1A enhancer-binding protein antibody|E1A F antibody|E1A-F antibody|ETS translocation variant 4 antibody|ets variant gene 4 (E1A enhancer binding protein E1AF) antibody|ETV4 antibody|ETV4_HUMAN antibody| PEA3 antibody|PEA3 protein antibody|PEAS3 antibody|Polyomavirus enhancer activator 3 antibody|Polyomavirus enhancer activator 3 homolog antibody|Protein PEA3 antibody

ID gène: 2118

UniProt: P43268