FABP1 anticorps (N-Term)
-
- Antigène Voir toutes FABP1 Anticorps
- FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))
-
Épitope
- AA 6-36, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FABP1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- KYQLQSQENF EAFMKAIGLP EELIQKGKDI K
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 1, liver
Protein Name: Fatty acid-binding protein, liver - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product FABP1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))
- Autre désignation
- FABP1 (FABP1 Produits)
- Synonymes
- anticorps FABPL, anticorps L-FABP, anticorps KAT4, anticorps KATIV, anticorps mitAAT, anticorps Fabpl, anticorps Fabplg, anticorps SCP, anticorps SCP., anticorps p14, anticorps FABP1, anticorps FABP, anticorps LFABP, anticorps liver, anticorps fabp1, anticorps Fabp1, anticorps FABP-1, anticorps FABPpm, anticorps mAspAT, anticorps fatty acid binding protein 1, anticorps glutamic-oxaloacetic transaminase 2, anticorps fatty acid binding protein 1, liver, anticorps fatty acid binding protein 1a, liver, anticorps fatty acid-binding protein, liver, anticorps FABP1, anticorps GOT2, anticorps Fabp1, anticorps fabp1a, anticorps LOC100726384
- Sujet
-
Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.
Synonyms: FABP 1 antibody|FABP1 antibody|FABP-1 antibody|FABPL antibody|FABPL_HUMAN antibody|Fatty Acid Binding Protein 1 antibody|Fatty acid binding protein 1 liver antibody|Fatty Acid Binding Protein antibody|Fatty acid-binding protein 1 antibody|Fatty acid-binding protein antibody|Fatty acid-binding protein liver antibody|L FABP antibody|L-FABP antibody|liver antibody|Liver-type fatty acid-binding protein antibody - ID gène
- 2168
- UniProt
- P07148
- Pathways
- Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha
-