Fascin anticorps (N-Term)
-
- Antigène Voir toutes Fascin (FSCN1) Anticorps
- Fascin (FSCN1)
-
Épitope
- AA 42-73, N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fascin est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human,Rat.
- Séquence
- KKQIWTLEQP PDEAGSAAVC LRSHLGRYLA AD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human,Rat.
Gene Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
Protein Name: Fascin - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product FSCN1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Overexpression of FOXM1 is associated with metastases of nasopharyngeal carcinoma." dans: Upsala journal of medical sciences, Vol. 119, Issue 4, pp. 324-32, (2014) (PubMed).
: "
-
Overexpression of FOXM1 is associated with metastases of nasopharyngeal carcinoma." dans: Upsala journal of medical sciences, Vol. 119, Issue 4, pp. 324-32, (2014) (PubMed).
-
- Antigène
- Fascin (FSCN1)
- Autre désignation
- FSCN1 (FSCN1 Produits)
- Synonymes
- anticorps CG15331, anticorps CG1536, anticorps CG32858, anticorps Dmel\\CG32858, anticorps SN, anticorps Sn, anticorps fs(1)A1057, anticorps fs(1)K1421, anticorps fs(1)K418, anticorps fs(1)K473, anticorps fs(1)K743, anticorps fs(1)M45, anticorps p55, anticorps snl, anticorps MGC75811, anticorps fscn1, anticorps sb:cb589, anticorps zgc:153632, anticorps AI663989, anticorps Fan1, anticorps fascin-1, anticorps Fascin, anticorps fscn, anticorps FAN1, anticorps HSN, anticorps SNL, anticorps fascin, anticorps singed, anticorps fascin actin-bundling protein 1, anticorps fascin actin-bundling protein 1a, anticorps fascin actin-bundling protein 1 L homeolog, anticorps sn, anticorps fscn1, anticorps fscn1a, anticorps Fscn1, anticorps fscn1.L, anticorps FSCN1
- Sujet
-
Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.
Synonyms: 55 kDa actin bundling protein antibody|55 kDa actin-bundling protein antibody|Actin bundling protein antibody|actin bundling protein, 55-KD antibody|FAN 1 antibody|FAN1 antibody|Fascin 1 antibody|Fascin antibody|Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody|Fascin homolog 1 antibody|Fascin, sea urchin, homolog of, 1 antibody|Fascin1 antibody| FLJ38511 antibody|FSCN 1 antibody|FSCN1 antibody|FSCN1_HUMAN antibody|HSN antibody|p55 antibody|Singed (Drosophila) like (sea urchin fascin homolog like) antibody|Singed drosophila homolog like antibody|Singed like (fascin homolog sea urchin) (Drosophila) antibody| Singed like (fascin homolog sea urchin) antibody|Singed like protein antibody|Singed, drosophila, homolog of antibody|Singed-like protein antibody|SNL antibody|Strongylocentrotus purpuratus antibody - ID gène
- 6624
- UniProt
- Q16658
-