Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Fascin anticorps (N-Term)

FSCN1 Reactivité: Humain, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3042407
  • Antigène Voir toutes Fascin (FSCN1) Anticorps
    Fascin (FSCN1)
    Épitope
    • 16
    • 15
    • 5
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 42-73, N-Term
    Reactivité
    • 90
    • 52
    • 30
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Humain, Rat
    Hôte
    • 76
    • 36
    • 1
    • 1
    Lapin
    Clonalité
    • 67
    • 47
    Polyclonal
    Conjugué
    • 47
    • 13
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Cet anticorp Fascin est non-conjugé
    Application
    • 80
    • 47
    • 38
    • 32
    • 28
    • 28
    • 20
    • 14
    • 11
    • 7
    • 6
    • 3
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human,Rat.
    Séquence
    KKQIWTLEQP PDEAGSAAVC LRSHLGRYLA AD
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human,Rat.
    Gene Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
    Protein Name: Fascin
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product FSCN1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Jiang, Wang, Chen: "Overexpression of FOXM1 is associated with metastases of nasopharyngeal carcinoma." dans: Upsala journal of medical sciences, Vol. 119, Issue 4, pp. 324-32, (2014) (PubMed).

  • Antigène
    Fascin (FSCN1)
    Autre désignation
    FSCN1 (FSCN1 Produits)
    Synonymes
    anticorps CG15331, anticorps CG1536, anticorps CG32858, anticorps Dmel\\CG32858, anticorps SN, anticorps Sn, anticorps fs(1)A1057, anticorps fs(1)K1421, anticorps fs(1)K418, anticorps fs(1)K473, anticorps fs(1)K743, anticorps fs(1)M45, anticorps p55, anticorps snl, anticorps MGC75811, anticorps fscn1, anticorps sb:cb589, anticorps zgc:153632, anticorps AI663989, anticorps Fan1, anticorps fascin-1, anticorps Fascin, anticorps fscn, anticorps FAN1, anticorps HSN, anticorps SNL, anticorps fascin, anticorps singed, anticorps fascin actin-bundling protein 1, anticorps fascin actin-bundling protein 1a, anticorps fascin actin-bundling protein 1 L homeolog, anticorps sn, anticorps fscn1, anticorps fscn1a, anticorps Fscn1, anticorps fscn1.L, anticorps FSCN1
    Sujet
    Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.

    Synonyms: 55 kDa actin bundling protein antibody|55 kDa actin-bundling protein antibody|Actin bundling protein antibody|actin bundling protein, 55-KD antibody|FAN 1 antibody|FAN1 antibody|Fascin 1 antibody|Fascin antibody|Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody|Fascin homolog 1 antibody|Fascin, sea urchin, homolog of, 1 antibody|Fascin1 antibody| FLJ38511 antibody|FSCN 1 antibody|FSCN1 antibody|FSCN1_HUMAN antibody|HSN antibody|p55 antibody|Singed (Drosophila) like (sea urchin fascin homolog like) antibody|Singed drosophila homolog like antibody|Singed like (fascin homolog sea urchin) (Drosophila) antibody| Singed like (fascin homolog sea urchin) antibody|Singed like protein antibody|Singed, drosophila, homolog of antibody|Singed-like protein antibody|SNL antibody|Strongylocentrotus purpuratus antibody
    ID gène
    6624
    UniProt
    Q16658
Vous êtes ici:
Support technique