HAVCR1 anticorps (C-Term)

N° du produit ABIN3042438

Détail du produit anti-HAVCR1 anticorps

Antigène: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Épitope: AA 321-359, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAVCR1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1(HAVcr-1)(HAVCR1) detection. Tested with WB in Human.

Séquence: QQLSVSFSSL QIKALQNAVE KEVQAEDNIY IENSLYATD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1(HAVcr-1)(HAVCR1) detection. Tested with WB in Human.
Gene Name: hepatitis A virus cellular receptor 1
Protein Name: Hepatitis A virus cellular receptor 1(HAVcr-1)

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HAVCR1

Antigène: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Autre désignation: HAVCR1 (HAVCR1 Produits)

Synonymes: anticorps HAVCR, anticorps HAVCR-1, anticorps KIM-1, anticorps KIM1, anticorps TIM, anticorps TIM-1, anticorps TIM1, anticorps TIMD-1, anticorps TIMD1, anticorps Kim1, anticorps HAVCR1, anticorps LOC100226241, anticorps AI503787, anticorps Tim1, anticorps Timd1, anticorps hepatitis A virus cellular receptor 1, anticorps hepatitis A virus cellular receptor 1 homolog, anticorps HAVCR1, anticorps Havcr1, anticorps LOC100226241

Classe de substances: Virus

Sujet: KIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cells differentiated in Th2-polarizing conditions. Ectopic expression of KIM1 during mouse T-cell differentiation leads to production of the Th2-type cytokine Il4, but not the Th1-type cytokine Ifng. KIM1-expressing epithelial cells internalized apoptotic bodies, and Kim1 is directly responsible for phagocytosis in cultured primary rat tubule epithelial cells and in porcine and canine epithelial cell lines.

Synonyms: HAVCR 1 antibody|HAVcr-1 antibody|HAVCR1 antibody|Hepatitis A virus cellular receptor 1 antibody|Kidney injury molecule 1 antibody|KIM 1 antibody|KIM-1 antibody|T cell immunoglobin domain and mucin domain protein 1 antibody|T-cell immunoglobulin and mucin domain-containing protein 1 antibody|T-cell membrane protein 1 antibody|TIM antibody|TIM-1 antibody|TIM1 antibody|TIMD 1 antibody|TIMD-1 antibody|TIMD1 antibody|TIMD1_HUMAN antibody

ID gène: 26762

UniProt: Q96D42