SP1 anticorps (C-Term)

N° du produit ABIN3042489

Détail du produit anti-SP1 anticorps

Antigène: SP1 (Sp1 Transcription Factor (SP1))

Épitope: AA 752-785, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SP1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Transcription factor Sp1(SP1) detection. Tested with WB in Human.

Séquence: EAICPEGIAR LANSGINVMQ VADLQSINIS GNGF

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Transcription factor Sp1(SP1) detection. Tested with WB in Human.
Gene Name: Sp1 transcription factor
Protein Name: Transcription factor Sp1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for SP1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-SP1 (ABIN3042489)

Zhang, Liu, Liu, Zhou, Song, Cao, An: "miR-182 aids in receptive endometrium development in dairy goats by down-regulating PTN expression." dans: PLoS ONE, Vol. 12, Issue 7, pp. e0179783, (2017) (PubMed).

Détails sur SP1

Antigène: SP1 (Sp1 Transcription Factor (SP1))

Autre désignation: SP1 (SP1 Produits)

Synonymes: anticorps fc18h09, anticorps zgc:85950, anticorps wu:fc18h09, anticorps SP1, anticorps 1110003E12Rik, anticorps AA450830, anticorps AI845540, anticorps Sp1-1, anticorps sp1 transcription factor, anticorps Sp1 transcription factor, anticorps Sp1 transcription factor L homeolog, anticorps trans-acting transcription factor 1, anticorps sp1, anticorps SP1, anticorps Sp1, anticorps sp1.L

Sujet: SP1(transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.

Synonyms: SP 1 antibody|SP1 antibody|Sp1 transcription factor antibody|SP1_HUMAN antibody|Specificity protein 1 antibody|Transcription factor Sp1 antibody|TSFP 1 antibody|TSFP1 antibody

ID gène: 6667

UniProt: P08047

Pathways: Regulation of Lipid Metabolism by PPARalpha, Myometrial Relaxation and Contraction