ICA1 anticorps (Middle Region)

N° du produit ABIN3042731

Détail du produit anti-ICA1 anticorps

Antigène: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Épitope: AA 243-276, Middle Region

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICA1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: EKTSHTMAAI HESFKGYQPY EFTTLKSLQD PMKK

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: islet cell autoantigen 1, 69 kDa
Protein Name: Islet cell autoantigen 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ICA1

Antigène: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Autre désignation: ICA1 (ICA1 Produits)

Synonymes: anticorps ica1, anticorps MGC52730, anticorps ICA1, anticorps DKFZp469G0321, anticorps zgc:92566, anticorps 69kDa, anticorps ICA69, anticorps Ica69, anticorps MGC83241, anticorps ICAp69, anticorps islet cell autoantigen 1 L homeolog, anticorps islet cell autoantigen 1, anticorps Islet cell autoantigen 1, anticorps islet cell autoantigen 1 S homeolog, anticorps ica1.L, anticorps ICA1, anticorps ica1, anticorps ica69, anticorps Ica1, anticorps ica1.S

Sujet: Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Synonyms: 69 kDa islet cell autoantigen antibody|Diabetes mellitus type I autoantigen antibody|ICA 1 antibody|Ica1 antibody|ICA69 antibody|ICA69_HUMAN antibody|ICAp69 antibody|Islet cell autoantigen 1 (69kD) antibody|Islet cell autoantigen 1 69 kDa antibody|Islet cell autoantigen 1 antibody|Islet cell autoantigen 1 isoform antibody|Islet cell autoantigen p69 antibody|OTTHUMP00000200933 antibody|OTTHUMP00000200934 antibody|OTTHUMP00000200941 antibody|OTTHUMP00000200993 antibody|p69 antibody

ID gène: 3382

UniProt: Q05084