LCAT anticorps (C-Term)
-
- Antigène Voir toutes LCAT Anticorps
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
-
Épitope
- AA 389-423, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCAT est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Phosphatidylcholine-sterol acyltransferase(LCAT) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- QPVHLLPMNE TDHLNMVFSN KTLEHINAIL LGAYR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Phosphatidylcholine-sterol acyltransferase(LCAT) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lecithin-cholesterol acyltransferase
Protein Name: Phosphatidylcholine-sterol acyltransferase - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR), different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LCAT Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
- Autre désignation
- LCAT (LCAT Produits)
- Synonymes
- anticorps AI046659, anticorps D8Wsu61e, anticorps MGC82035, anticorps lcat, anticorps MGC88964, anticorps LCAT, anticorps lecithin-cholesterol acyltransferase, anticorps lecithin cholesterol acyltransferase, anticorps lecithin-cholesterol acyltransferase L homeolog, anticorps solute carrier family 12 member 4, anticorps fragile site, aphidicolin type, common, fra(13)(q13.2), anticorps LCAT, anticorps Lcat, anticorps lcat.L, anticorps lcat, anticorps SLC12A4, anticorps FRA13A
- Sujet
-
LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
Synonyms: LCAT antibody|LCAT_HUMAN antibody|Lecithin cholesterol acyltransferase antibody|Lecithin-cholesterol acyltransferase antibody| Phosphatidylcholine sterol acyltransferase antibody| Phosphatidylcholine-sterol acyltransferase antibody|Phospholipid cholesterol acyltransferase antibody|Phospholipid-cholesterol acyltransferase antibody - ID gène
- 16816
- UniProt
- P16301
- Pathways
- Lipid Metabolism
-