LGALS8 anticorps (C-Term)

N° du produit ABIN3043401

Détail du produit anti-LGALS8 anticorps

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Épitope: AA 286-317, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS8 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.

Séquence: HSLEYKHRFK ELSSIDTLEI NGDIHLLEVR SW

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
Gene Name: lectin, galactoside-binding, soluble, 8
Protein Name: Galectin-8

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur LGALS8

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Autre désignation: LGALS8 (LGALS8 Produits)

Synonymes: anticorps LGALS8, anticorps 1200015E08Rik, anticorps AI326142, anticorps D13Ertd524e, anticorps Lgals-8, anticorps galectin-8, anticorps Gal-8, anticorps PCTA-1, anticorps PCTA1, anticorps Po66-CBP, anticorps xgalectin-VIIIa, anticorps galectin 8, anticorps lectin, galactose binding, soluble 8, anticorps lectin, galactoside binding soluble 8 S homeolog, anticorps LGALS8, anticorps Lgals8, anticorps lgals8.S

Sujet: Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms: Gal 8 antibody|Gal-8 antibody|Gal8 antibody|Galectin-8 antibody|galectin-8g antibody|Lectin galactoside binding soluble 8 antibody| LEG8_HUMAN antibody|LGAL S8 antibody|Lgals8 antibody|PCTA 1 antibody|PCTA-1 antibody|PCTA1 antibody|Po66 carbohydrate binding protein antibody|Po66 carbohydrate-binding protein antibody|Po66 CBP antibody|Po66-CBP antibody|Prostate carcinoma tumor antigen 1 antibody

ID gène: 3964

UniProt: O00214