APH1A anticorps (C-Term)
-
- Antigène Voir toutes APH1A Anticorps
- APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))
-
Épitope
- AA 236-265, C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APH1A est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1A(APH1A) detection. Tested with WB in Human,Mouse.
- Séquence
- LRSIQRSLLC RRQEDSRVMV YSALRIPPED
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1A(APH1A) detection. Tested with WB in Human,Mouse.
Gene Name: APH1A gamma secretase subunit
Protein Name: Gamma-secretase subunit APH-1A - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product APH1A Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for APH1a is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))
- Autre désignation
- APH1A (APH1A Produits)
- Synonymes
- anticorps 6530402N02Rik, anticorps APH-1, anticorps APH-1A, anticorps CGI-78, anticorps RGD1311546, anticorps APH-1a, anticorps aph-1 homolog A, gamma-secretase subunit, anticorps aph-1 homolog A, gamma secretase subunit L homeolog, anticorps aph-1 homolog A, gamma secretase subunit, anticorps anterior pharynx defective 1 homolog A (C. elegans), anticorps aph1 homolog A, gamma secretase subunit, anticorps acylamino-acid-releasing enzyme-like, anticorps APH1A, anticorps aph1a.L, anticorps Aph1a, anticorps LOC100219182
- Sujet
-
APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.
Synonyms: 6530402N02Rik antibody|AL138795.3 antibody|Anterior Pharynx Defective 1 antibody|Anterior pharynx defective 1 homolog A antibody|APH 1A antibody|Aph 1alpha antibody|APH-1a antibody| Aph-1alpha antibody|Aph1a antibody|APH1A gamma secretase subunit antibody|APH1A_HUMAN antibody|CGI 78 antibody|CGI78 antibody|Gamma secretase subunit APH 1A antibody|Gamma Secretase Subunit APH1a antibody|Gamma-secretase subunit APH-1A antibody|Likely ortholog of C. elegans anterior pharynx defective 1A antibody|Presenilin Stabilization Factor antibody| Presenilin-stabilization factor antibody|PSF antibody|UNQ579/PRO1141 antibody - ID gène
- 51107
- Pathways
- Signalisation Notch, Neurotrophin Signaling Pathway
-