Prolactin Receptor anticorps (C-Term)

N° du produit ABIN3043553

Détail du produit anti-Prolactin Receptor anticorps

Antigène: Prolactin Receptor (PRLR)

Épitope: AA 565-605, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Prolactin Receptor est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.

Séquence: HAKNVACFEE SAKEAPPSLE QNQAEKALAN FTATSSKCRL Q

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.
Gene Name: prolactin receptor
Protein Name: Prolactin receptor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Prolactin Receptor (ABIN3043553)

Zhang, Liu, Liu, Zhou, Song, Cao, An: "miR-182 aids in receptive endometrium development in dairy goats by down-regulating PTN expression." dans: PLoS ONE, Vol. 12, Issue 7, pp. e0179783, (2017) (PubMed).

Détails sur Prolactin Receptor

Antigène: Prolactin Receptor (PRLR)

Autre désignation: PRLR (PRLR Produits)

Synonymes: anticorps hPRLrI, anticorps PRL-R, anticorps prlr, anticorps PRLRb, anticorps PRLR, anticorps tprlr, anticorps DKFZp469D061, anticorps RATPRLR, anticorps AI987712, anticorps Pr-1, anticorps Pr-3, anticorps Prlr-rs1, anticorps wu:fj65c07, anticorps prolactin receptor, anticorps prolactin receptor L homeolog, anticorps prolactin receptor S homeolog, anticorps prolactin receptor a, anticorps PRLR, anticorps prlr.L, anticorps prlr.S, anticorps PR, anticorps prlr, anticorps Prlr, anticorps prlra

Sujet: PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands.

Synonyms: AI987712 antibody|CLONE SPM213 antibody|CPRLP antibody|Delta 4-delta 7/11 truncated prolactin receptor antibody|Delta 4-SF1b truncated prolactin receptor antibody|hPRL receptor antibody|hPRLrI antibody|Lactogen receptor antibody|MGC105486 antibody|OPR antibody| OTTHUMP00000115998 antibody|Pr-1 antibody|Pr-3 antibody|PRL R antibody|PRL-R antibody|PRLR antibody|Prlr-rs1 antibody|PRLR_HUMAN antibody|Prolactin receptor a antibody| Prolactin receptor antibody|Prolactin receptor delta 7/11 antibody|RATPRLR antibody| Secreted prolactin binding protein antibody|Truncated testis-specific box 1-C prolactin receptor antibody|wu:fj65c07 antibody

ID gène: 5618

UniProt: P16471

Pathways: Signalistation JAK/STAT, Response to Growth Hormone Stimulus