NR3C2 anticorps (C-Term)

N° du produit ABIN3043575

Détail du produit anti-NR3C2 anticorps

Antigène: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Épitope: AA 950-984, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR3C2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: HALKVEFPAM LVEIISDQLP KVESGNAKPL YFHRK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: nuclear receptor subfamily 3, group C, member 2
Protein Name: Mineralocorticoid receptor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-NR3C2 (ABIN3043575)

Rigiracciolo, Scarpelli, Lappano, Pisano, Santolla, Avino, De Marco, Bussolati, Maggiolini, De Francesco: "GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells." dans: Oncotarget, Vol. 7, Issue 1, pp. 94-111, (2016) (PubMed).

Détails sur NR3C2

Antigène: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Autre désignation: NR3C2 (NR3C2 Produits)

Synonymes: anticorps mr, anticorps si:ch211-189l17.1, anticorps LOC100302443, anticorps NR3C2, anticorps LOC443144, anticorps MLR, anticorps MR, anticorps MCR, anticorps NR3C2VIT, anticorps Mlr, anticorps mlr, anticorps nuclear receptor subfamily 3, group C, member 2, anticorps nuclear receptor subfamily 3 group C member 2, anticorps mineralocorticoid receptor, anticorps nuclear receptor subfamily 3 group C member 2 L homeolog, anticorps nr3c2, anticorps NR3C2, anticorps LOC443144, anticorps Nr3c2, anticorps nr3c2.L

Sujet: NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

Synonyms: Aldosterone receptor antibody|MCR antibody|MCR_HUMAN antibody|MGC133092 antibody| Mineralocorticoid receptor antibody|MLR antibody|MR antibody|NR3 C2 antibody|NR3C2 antibody|NR3C2 protein antibody|Nuclear receptor subfamily 3 group C member 2 antibody

ID gène: 4306

UniProt: P08235

Pathways: ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway