MMP 9 anticorps (C-Term)

N° du produit ABIN3043582

Détail du produit anti-MMP 9 anticorps

Antigène: MMP 9 (MMP9) (Matrix Metallopeptidase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase) (MMP9))

Épitope: AA 633-667, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP 9 est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, ELISA in Human.

Séquence: WRFDVKAQMV DPRSASEVDR MFPGVPLDTH DVFQY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, ELISA in Human.
Gene Name: matrix metallopeptidase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase)
Protein Name: Matrix metalloproteinase-9

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-MMP 9 (ABIN3043582)

Liu, Li, Li, Teng, Wang, Zhang, Xiao: "TGF-β1 promotes scar fibroblasts proliferation and transdifferentiation via up-regulating MicroRNA-21." dans: Scientific reports, Vol. 6, pp. 32231, (2018) (PubMed).

Li, Xiao, Li, Li, Zeng, Liu, Liang, Li, Chu, Yang: "Hydrogen sulfide reduced renal tissue fibrosis by regulating autophagy in diabetic rats." dans: Molecular medicine reports, Vol. 16, Issue 2, pp. 1715-1722, (2018) (PubMed).

Zhao, Han, Hong, Sun: "Adipose differentiation‑related protein knockdown inhibits vascular smooth muscle cell proliferation and migration and attenuates neointima formation." dans: Molecular medicine reports, Vol. 16, Issue 3, pp. 3079-3086, (2018) (PubMed).

Li, Peng, Zhang, Liu, Li, Chen, Sun, Zhu, Zhang: "Mesenchymal stem cells overexpressing adrenomedullin improve heart function through antifibrotic action in rats experiencing heart failure." dans: Molecular medicine reports, Vol. 17, Issue 1, pp. 1437-1444, (2018) (PubMed).

Liu, Zeng, Wang, Li, Mastriani, Li, Bao, Zhou, Wang, Liu, Liu, Hu, Gao, Yu, Qi, Shen, Wang, Gao, Dong, Johnston, Liu: "Main components of pomegranate, ellagic acid and luteolin, inhibit metastasis of ovarian cancer by down-regulating MMP2 and MMP9." dans: Cancer biology & therapy, Vol. 18, Issue 12, pp. 990-999, (2018) (PubMed).

Bai, Luo: "5-Hydroxy-4'-Nitro-7-Propionyloxy-Genistein Inhibited Invasion and Metastasis via Inactivating Wnt/b-Catenin Signal Pathway in Human Endometrial Carcinoma Ji Endometrial Cells." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 24, pp. 3230-3243, (2018) (PubMed).

Xu, Hu, Khan, Shi, Cong, Li, Dai, Dai: "Argirein alleviates stress-induced and diabetic hypogonadism in rats via normalizing testis endothelin receptor A and connexin 43." dans: Acta pharmacologica Sinica, Vol. 37, Issue 2, pp. 246-54, (2017) (PubMed).

Chen, Kong, Liu, Gao, Zhang, Li, Liu: "In vitro differentiation of endometrial regenerative cells into smooth muscle cells: Α potential approach for the management of pelvic organ prolapse." dans: International journal of molecular medicine, Vol. 38, Issue 1, pp. 95-104, (2017) (PubMed).

Zhang, Si, Huang, Han, Liang, Xu, Wang, Li, Wang, Wang: "Preventive Effects of Rhodiola rosea L. on Bleomycin-Induced Pulmonary Fibrosis in Rats." dans: International journal of molecular sciences, Vol. 17, Issue 6, (2017) (PubMed).

Li, Chen, Chen, Mo, Li, Xiao, Yu, Guo: "Circular RNA 0000096 affects cell growth and migration in gastric cancer." dans: British journal of cancer, Vol. 116, Issue 5, pp. 626-633, (2017) (PubMed).

Xu, Xu, Li, Wang, Fu, Jia, Wang, Zhu, Lu, Yao: "Growth differentiation factor 15 induces growth and metastasis of human liver cancer stem-like cells via AKT/GSK-3β/β-catenin signaling." dans: Oncotarget, Vol. 8, Issue 10, pp. 16972-16987, (2017) (PubMed).

Guo, Zhang, Wei, Wang, Lv, Zhang, Keller, Yao, Wang: "Cytotoxic necrotizing factor 1 promotes prostate cancer progression through activating the Cdc42-PAK1 axis." dans: The Journal of pathology, Vol. 243, Issue 2, pp. 208-219, (2017) (PubMed).

Huang, Huang, Feng, Ren, Mi, Cheng, Song, Lang: "Early changes in the apparent diffusion coefficient and MMP-9 expression of a cervical carcinoma U14 allograft model following irradiation." dans: Oncology letters, Vol. 14, Issue 6, pp. 6769-6775, (2017) (PubMed).

Pan, An, Meng, Li, Ren, Guan: "MgCl2 and ZnCl2 promote human umbilical vein endothelial cell migration and invasion and stimulate epithelial-mesenchymal transition via the Wnt/β-catenin pathway." dans: Experimental and therapeutic medicine, Vol. 14, Issue 5, pp. 4663-4670, (2017) (PubMed).

Wang, Liang, Wang, Zhu, Gong, Zhang, Li, Xia: "Th17 down-regulation is involved in reduced progression of schistosomiasis fibrosis in ICOSL KO mice." dans: PLoS neglected tropical diseases, Vol. 9, Issue 1, pp. e0003434, (2016) (PubMed).

Li, Luo, Liu, Fu, Xu, Wu, Shen: "Effect of Ginkgo biloba extract on experimental cardiac remodeling." dans: BMC complementary and alternative medicine, Vol. 15, pp. 277, (2016) (PubMed).

Jiang, Ma, Liang, Niu, Chen, Shen: "Amniotic Mesenchymal Stem Cells Can Enhance Angiogenic Capacity via MMPs In Vitro and In Vivo." dans: BioMed research international, Vol. 2015, pp. 324014, (2016) (PubMed).

Han, Wang, Huang, Cheng, Sun, Chen, Xie, Zhou, Du: "Isolation and characteristics of CD133‑/A2B5+ and CD133‑/A2B5‑ cells from the SHG139s cell line." dans: Molecular medicine reports, Vol. 12, Issue 6, pp. 7949-56, (2016) (PubMed).

Fan, Jiang, Li, Fang, Xu, Zheng: "MMP-1/2 and TIMP-1/2 expression levels, and the levels of collagenous and elastic fibers correlate with disease progression in a hamster model of tongue cancer." dans: Oncology letters, Vol. 11, Issue 1, pp. 63-68, (2016) (PubMed).

Wang, Qiu, Ren: "Inhibition of acute lung injury by rubriflordilactone in LPS-induced rat model through suppression of inflammatory factor expression." dans: International journal of clinical and experimental pathology, Vol. 8, Issue 12, pp. 15954-9, (2016) (PubMed).

Détails sur MMP 9

Antigène: MMP 9 (MMP9) (Matrix Metallopeptidase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase) (MMP9))

Autre désignation: MMP9 (MMP9 Produits)

Synonymes: anticorps CLG4B, anticorps GELB, anticorps MANDP2, anticorps MMP-9, anticorps AW743869, anticorps B/MMP9, anticorps Clg4b, anticorps pro-MMP-9, anticorps mmp-9, anticorps fgMMP-9, anticorps mmp9, anticorps ZFMMP-9, anticorps wu:fb02g06, anticorps wu:fb07b05, anticorps wu:fi98c09, anticorps wu:fj05a08, anticorps zgc:64165, anticorps clg4b, anticorps gelb, anticorps mandp2, anticorps matrix metallopeptidase 9, anticorps collagenase, anticorps matrix metalloproteinase 9, anticorps matrix metallopeptidase 9 S homeolog, anticorps MMP9, anticorps RB3913, anticorps BPSS0666, anticorps Sbal_3732, anticorps Bcer98_0486, anticorps Shew185_0630, anticorps Shal_3056, anticorps Sbal195_0657, anticorps Lbys_3550, anticorps Palpr_2084, anticorps Mmp9, anticorps mmp9, anticorps mmp9.S

Sujet: Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Synonyms: 82 kDa matrix metalloproteinase-9 antibody|92 kDa gelatinase antibody|92 kDa type IV collagenase antibody|CLG 4B antibody|CLG4B antibody|Collagenase Type 4 beta antibody| Collagenase type IV 92 KD antibody|EC 3.4.24.35 antibody|Gelatinase 92 KD antibody| Gelatinase B antibody|Gelatinase beta antibody|GelatinaseB antibody|GELB antibody| Macrophage gelatinase antibody|MANDP2 antibody| Matrix metallopeptidase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) antibody|Matrix Metalloproteinase 9 antibody| MMP 9 antibody|MMP-9 antibody|MMP9 antibody|MMP9_HUMAN antibody|Type V collagenase antibody

ID gène: 4318

UniProt: P14780

Pathways: Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events