FABP4 anticorps (N-Term)

N° du produit ABIN3043827

Détail du produit anti-FABP4 anticorps

Antigène: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Épitope: AA 10-40, N-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KLVSSENFDD YMKEVGVGFA TRKVAGMAKP N

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 4, adipocyte
Protein Name: Fatty acid-binding protein, adipocyte

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FABP4

Antigène: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Autre désignation: FABP4 (FABP4 Produits)

Synonymes: anticorps A-FABP, anticorps AFABP, anticorps ALBP, anticorps aP2, anticorps LOC100223994, anticorps FABP, anticorps AP2, anticorps FABP3, anticorps FABP4, anticorps MGC84940, anticorps fabp4, anticorps 422/aP2, anticorps ALBP/Ap2, anticorps Ap2, anticorps Lbpl, anticorps Albp, anticorps fatty acid binding protein 4, anticorps fatty acid-binding protein, adipocyte, anticorps fatty acid binding protein 4, adipocyte, anticorps fatty acid binding protein 4, adipocyte L homeolog, anticorps Fatty acid-binding protein, adipocyte, anticorps adipocyte fatty acid-binding protein, anticorps adipocyte fatty acid binding protein, anticorps FABP4, anticorps LOC100223994, anticorps fabp4.L, anticorps fabp4, anticorps Fabp4, anticorps LOC100732353, anticorps LOC100861279, anticorps LOC100057425, anticorps LOC395224

Sujet: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

Synonyms: 3T3-L1 lipid-binding protein antibody|422/aP2 antibody|A FABP antibody|A-FABP antibody|adipocyte antibody|Adipocyte lipid binding protein antibody|Adipocyte lipid-binding protein antibody|Adipocyte protein AP2 antibody|Adipocyte-type fatty acid-binding protein antibody|AFABP antibody|ALBP antibody|ALBP/Ap2 antibody|aP2 antibody|FABP antibody|FABP4 antibody|FABP4_HUMAN antibody|Fatty acid binding protein 4 adipocyte antibody|Fatty acid binding protein 4 antibody|Fatty acid binding protein adipocyte antibody|Fatty acid-binding protein 4 antibody|Fatty acid-binding protein antibody|Lbpl antibody|Myelin P2 protein homolog antibody|P15 antibody|P2 adipocyte protein antibody|Protein 422 antibody

ID gène: 2167

UniProt: P15090

Pathways: Brown Fat Cell Differentiation