Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

HSP90AA1 anticorps (C-Term)

HSP90AA1 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043848
  • Antigène Voir toutes HSP90AA1 Anticorps
    HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))
    Épitope
    • 7
    • 5
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 454-488, C-Term
    Reactivité
    • 83
    • 53
    • 42
    • 14
    • 14
    • 12
    • 12
    • 9
    • 9
    • 7
    • 7
    • 6
    • 5
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 55
    • 27
    • 5
    Lapin
    Clonalité
    • 52
    • 35
    Polyclonal
    Conjugué
    • 64
    • 9
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp HSP90AA1 est non-conjugé
    Application
    • 76
    • 31
    • 24
    • 24
    • 23
    • 21
    • 19
    • 6
    • 4
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    QNRKKLSELL RYYTSASGDE MVSLKDYCTR MKEN
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: heat shock protein 90 kDa alpha (cytosolic), class A member 1
    Protein Name: Heat shock protein HSP 90-alpha
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product HSP90AA1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Cheng, Zhao, Wang, Lu, Wang, Wang, Yao: "The effect of 5'-adenylic acid on hepatic proteome of mice radiated by 60Co γ-ray." dans: International journal of molecular sciences, Vol. 15, Issue 1, pp. 186-202, (2014) (PubMed).

    Jiang, Wang, Li, Shi, Li, Ma, Li, Luo, Yang, Xu: "Heat shock protein 90-mediated inactivation of nuclear factor-?B switches autophagy to apoptosis through becn1 transcriptional inhibition in selenite-induced NB4 cells." dans: Molecular biology of the cell, Vol. 22, Issue 8, pp. 1167-80, (2011) (PubMed).

  • Antigène
    HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))
    Autre désignation
    HSP90AA1 (HSP90AA1 Produits)
    Synonymes
    anticorps EL52, anticorps HSP86, anticorps HSP89A, anticorps HSP90A, anticorps HSP90N, anticorps HSPC1, anticorps HSPCA, anticorps HSPCAL1, anticorps HSPCAL4, anticorps HSPN, anticorps Hsp89, anticorps Hsp90, anticorps LAP2, anticorps Hsp86, anticorps Hspca, anticorps htpG, anticorps 86kDa, anticorps 89kDa, anticorps AL024080, anticorps AL024147, anticorps Hsp86-1, anticorps hsp4, anticorps HSP90, anticorps HSP90AA1, anticorps fb17b01, anticorps hsp90, anticorps hsp90a, anticorps hsp90a.1, anticorps hsp90alpha, anticorps wu:fb17b01, anticorps zgc:86652, anticorps Hsp90alpha, anticorps heat shock protein 90 alpha family class A member 1, anticorps heat shock protein 90, alpha (cytosolic), class A member 1, anticorps Heat Shock Protein 90, cytosolic, anticorps heat shock protein 90A, anticorps molecular chaperone, anticorps heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1, anticorps heat shock protein HSP 90-alpha, anticorps heat shock protein 90kDa alpha (cytosolic), class A member 1, anticorps HSP90AA1, anticorps Hsp90aa1, anticorps HSP90A, anticorps hsp90A, anticorps hsp90aa1.1, anticorps LOC108698781
    Sujet
    Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90- kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85 % amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

    Synonyms: EL52 antibody|epididymis luminal secretory protein 52 antibody|Heat shock 86 kDa antibody|heat shock 90kD protein 1, alpha antibody| Heat shock 90kD protein 1, alpha like 4 antibody|heat shock 90kD protein, alpha-like 4 antibody|Heat shock 90 kDa protein 1 alpha antibody|Heat shock protein 90 kDa alpha (cytosolic) class A member 1 antibody|heat shock protein 90 kDa alpha (cytosolic), class A member 2 antibody|Heat shock protein HSP 90-alpha antibody|HS90A_HUMAN antibody|HSP 86 antibody|HSP 86 antibody|HSP86 antibody|Hsp89 antibody|HSP89A antibody|Hsp90 antibody|HSP90A antibody|HSP90AA1 antibody|HSP90ALPHA antibody|HSP90N antibody|HSPC1 antibody|HSPCA antibody|HSPCAL1 antibody|HSPCAL3 antibody|HSPCAL4 antibody|HSPN antibody|LAP 2 antibody|LAP2 antibody|lipopolysaccharide-associated protein 2 antibody|LPS-associated protein 2 antibody|Renal carcinoma antigen NY REN 38 antibody|Renal carcinoma antigen NY-REN-38 antibody
    ID gène
    3320
    UniProt
    P07900
    Pathways
    M Phase, Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
Vous êtes ici:
Support technique